PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S18153.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 145aa    MW: 16715.3 Da    PI: 10.8093
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S18153.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.3e-293586152
         RWP-RK  1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                   aek+isl+ l++yF+ ++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  Jcr4S18153.10 35 AEKTISLQILRQYFARSLKDAAKSLGVCPTTVKRICRQHGINRWPSRKIKKV 86
                   589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.57425106IPR003035RWP-RK domain
PfamPF020422.3E-253886IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MDKAKENFTF VSRECLKEEH EEEFKVISEK RQTKAEKTIS LQILRQYFAR SLKDAAKSLG  60
VCPTTVKRIC RQHGINRWPS RKIKKVNRSL KKLQLVVNSI RSDFGTEKSK IKQNTKALAR  120
SSHAIQHSRA GIKENQYGDS EPSMP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002532423.13e-36PREDICTED: protein NLP2 isoform X1
RefseqXP_015582869.13e-36PREDICTED: protein NLP2 isoform X1
RefseqXP_015582870.13e-36PREDICTED: protein NLP2 isoform X2
SwissprotQ7X9B93e-35NLP2_ARATH; Protein NLP2
TrEMBLA0A067LB885e-47A0A067LB88_JATCU; Uncharacterized protein
STRINGPOPTR_0002s01060.18e-34(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.14e-35Nin-like family protein